SCOPe 2.08: Domain d4no1t_: 4no1 T:

Lineage for d4no1t_ (4no1 T:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4no1t_: 4no1 T: [240643]
   Other proteins in same PDB: d4no1a_, d4no1b_, d4no1c1, d4no1c2, d4no1d_, d4no1e_, d4no1g_, d4no1h_, d4no1i_, d4no1j_, d4no1k_, d4no1l_, d4no1m_, d4no1n_, d4no1o_, d4no1p_, d4no1q1, d4no1q2, d4no1r_, d4no1s_, d4no1u_, d4no1v_, d4no1w_, d4no1x_, d4no1y_, d4no1z_
   automated match to d1irug_
   complexed with cix, mg

Details for d4no1t_

PDB Entry: 4no1, 2.5 Å

PDB Description: ycp in complex with z-leu-leu-leu-b(oh)2

PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4no1t_:

Sequence; same for both SEQRES and ATOM records:

>d4no1t_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d4no1t_:

• d4no1t_ first appeared in SCOPe 2.04
  
• d4no1t_ appears in SCOPe 2.07