Lineage for d4nnra_ (4nnr A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644292Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1644293Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1644590Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1644591Protein automated matches [191162] (20 species)
    not a true protein
  7. 1644619Species Human (Homo sapiens) [TaxId:9606] [225017] (9 PDB entries)
  8. 1644637Domain d4nnra_: 4nnr A: [236624]
    automated match to d3kz7a_
    complexed with fk5

Details for d4nnra_

PDB Entry: 4nnr (more details), 1.98 Å

PDB Description: fkbp13-fk506 complex
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP2

SCOPe Domain Sequences for d4nnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnra_ d.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hcpiksrkgdvlhmhytgkledgtefdsslpqnqpfvfslgtgqvikgwdqgllgmcege
krklvipselgygergappkipggatlvfevellkierrtel

SCOPe Domain Coordinates for d4nnra_:

Click to download the PDB-style file with coordinates for d4nnra_.
(The format of our PDB-style files is described here.)

Timeline for d4nnra_: