SCOPe 2.08: Domain d4nnra_: 4nnr A:

Lineage for d4nnra_ (4nnr A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)

8. Domain d4nnra_: 4nnr A: [236624]
   automated match to d3kz7a_
   complexed with fk5

Details for d4nnra_

PDB Entry: 4nnr, 1.98 Å

PDB Description: fkbp13-fk506 complex

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP2

SCOPe Domain Sequences for d4nnra_:

Sequence; same for both SEQRES and ATOM records:

>d4nnra_ d.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hcpiksrkgdvlhmhytgkledgtefdsslpqnqpfvfslgtgqvikgwdqgllgmcege
krklvipselgygergappkipggatlvfevellkierrtel

Timeline for d4nnra_:

• d4nnra_ first appeared in SCOPe 2.03
  
• d4nnra_ appears in SCOPe 2.07