| Class b: All beta proteins [48724] (174 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.1: PHM/PNGase F [49742] (2 families) ![]() members of this superfamily bind peptide substrates duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits |
| Family b.121.1.1: Glycosyl-asparaginase [49743] (1 protein) |
| Protein Peptide:N-glycosidase F, PNGase F [49744] (1 species) |
| Species Flavobacterium meningosepticum [TaxId:238] [49745] (3 PDB entries) |
| Domain d1pnfa1: 1pnf A:1-140 [23655] complexed with so4 |
PDB Entry: 1pnf (more details), 2 Å
SCOPe Domain Sequences for d1pnfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnfa1 b.121.1.1 (A:1-140) Peptide:N-glycosidase F, PNGase F {Flavobacterium meningosepticum [TaxId: 238]}
apadntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewd
ryanvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetw
lakgreysvdfdivygtpdy
Timeline for d1pnfa1: