Lineage for d1pnfa1 (1pnf A:1-140)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821497Superfamily b.121.1: PHM/PNGase F [49742] (2 families) (S)
    members of this superfamily bind peptide substrates
    duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits
  5. 2821498Family b.121.1.1: Glycosyl-asparaginase [49743] (2 proteins)
  6. 2821499Protein Peptide:N-glycosidase F, PNGase F [49744] (1 species)
  7. 2821500Species Flavobacterium meningosepticum [TaxId:238] [49745] (3 PDB entries)
  8. 2821503Domain d1pnfa1: 1pnf A:1-140 [23655]
    complexed with so4

Details for d1pnfa1

PDB Entry: 1pnf (more details), 2 Å

PDB Description: pngase f complex with di-n-acetylchitobiose
PDB Compounds: (A:) peptide-n(4)-(n-acetyl-beta-d-glucosaminyl)asparagine amidase f

SCOPe Domain Sequences for d1pnfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnfa1 b.121.1.1 (A:1-140) Peptide:N-glycosidase F, PNGase F {Flavobacterium meningosepticum [TaxId: 238]}
apadntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewd
ryanvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetw
lakgreysvdfdivygtpdy

SCOPe Domain Coordinates for d1pnfa1:

Click to download the PDB-style file with coordinates for d1pnfa1.
(The format of our PDB-style files is described here.)

Timeline for d1pnfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pnfa2