Lineage for d1pnf_1 (1pnf 1-140)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11958Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 11959Superfamily b.13.1: PHM/PNGase F [49742] (2 families) (S)
  5. 11960Family b.13.1.1: Glycosyl-asparaginase [49743] (1 protein)
  6. 11961Protein Peptide:N-glycosidase F, PNGase F [49744] (1 species)
  7. 11962Species Flavobacterium meningosepticum [TaxId:238] [49745] (3 PDB entries)
  8. 11965Domain d1pnf_1: 1pnf 1-140 [23655]

Details for d1pnf_1

PDB Entry: 1pnf (more details), 2 Å

PDB Description: pngase f complex with di-n-acetylchitobiose

SCOP Domain Sequences for d1pnf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnf_1 b.13.1.1 (1-140) Peptide:N-glycosidase F, PNGase F {Flavobacterium meningosepticum}
apadntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewd
ryanvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetw
lakgreysvdfdivygtpdy

SCOP Domain Coordinates for d1pnf_1:

Click to download the PDB-style file with coordinates for d1pnf_1.
(The format of our PDB-style files is described here.)

Timeline for d1pnf_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pnf_2