SCOPe 2.07: Domain d4c8ib_: 4c8i B:

Lineage for d4c8ib_ (4c8i B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.0: automated matches [191525] (1 protein)
   not a true family

6. Protein automated matches [190884] (7 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [235915] (3 PDB entries)

8. Domain d4c8ib_: 4c8i B: [236297]
   automated match to d4c8gc_
   complexed with cit, po4, zn

Details for d4c8ib_

PDB Entry: 4c8i, 2 Å

PDB Description: ispf (burkholderia cenocepacia) citrate complex

PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d4c8ib_:

Sequence; same for both SEQRES and ATOM records:

>d4c8ib_ d.79.5.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mdvrigqgydvhqlvegrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdaafkgadsrvllracaervkaagftiqnvdstviaqapklaphidgmraniaa
dlglplervnvkaktneklgylgrgegieaqaaallvkq

Timeline for d4c8ib_:

• d4c8ib_ first appeared in SCOPe 2.03
  
• d4c8ib_ appears in SCOPe 2.06
  
• d4c8ib_ appears in the current release, SCOPe 2.08