![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.0: automated matches [191525] (1 protein) not a true family |
![]() | Protein automated matches [190884] (7 species) not a true protein |
![]() | Species Burkholderia cenocepacia [TaxId:216591] [235915] (3 PDB entries) |
![]() | Domain d4c8ib_: 4c8i B: [236297] automated match to d4c8gc_ complexed with cit, po4, zn |
PDB Entry: 4c8i (more details), 2 Å
SCOPe Domain Sequences for d4c8ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c8ib_ d.79.5.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} mdvrigqgydvhqlvegrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig rhfsdtdaafkgadsrvllracaervkaagftiqnvdstviaqapklaphidgmraniaa dlglplervnvkaktneklgylgrgegieaqaaallvkq
Timeline for d4c8ib_: