Lineage for d4c8ib_ (4c8i B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960358Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2960499Family d.79.5.0: automated matches [191525] (1 protein)
    not a true family
  6. 2960500Protein automated matches [190884] (7 species)
    not a true protein
  7. 2960501Species Burkholderia cenocepacia [TaxId:216591] [235915] (3 PDB entries)
  8. 2960506Domain d4c8ib_: 4c8i B: [236297]
    automated match to d4c8gc_
    complexed with cit, po4, zn

Details for d4c8ib_

PDB Entry: 4c8i (more details), 2 Å

PDB Description: ispf (burkholderia cenocepacia) citrate complex
PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d4c8ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c8ib_ d.79.5.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mdvrigqgydvhqlvegrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdaafkgadsrvllracaervkaagftiqnvdstviaqapklaphidgmraniaa
dlglplervnvkaktneklgylgrgegieaqaaallvkq

SCOPe Domain Coordinates for d4c8ib_:

Click to download the PDB-style file with coordinates for d4c8ib_.
(The format of our PDB-style files is described here.)

Timeline for d4c8ib_: