Lineage for d4caya_ (4cay A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1726113Protein automated matches [193445] (6 species)
    not a true protein
  7. 1726148Species Human (Homo sapiens) [TaxId:9606] [193446] (28 PDB entries)
  8. 1726149Domain d4caya_: 4cay A: [236116]
    automated match to d1kx3c_

Details for d4caya_

PDB Entry: 4cay (more details), 1.48 Å

PDB Description: crystal structure of a human anp32e-h2a.z-h2b complex
PDB Compounds: (A:) histone h2a.z

SCOPe Domain Sequences for d4caya_:

Sequence, based on SEQRES records: (download)

>d4caya_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskdlk
vkritprhlqlairgdeeldslikatiagg

Sequence, based on observed residues (ATOM records): (download)

>d4caya_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srsqraglqfpvgrihrhlksrgrvgataavysaaileyltaevlelagnaskdlkvkri
tprhlqlairgdeeldslikatiagg

SCOPe Domain Coordinates for d4caya_:

Click to download the PDB-style file with coordinates for d4caya_.
(The format of our PDB-style files is described here.)

Timeline for d4caya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4cayb_