SCOPe 2.06: Domain d4caya_: 4cay A:

Lineage for d4caya_ (4cay A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (46 PDB entries)

8. Domain d4caya_: 4cay A: [236116]
   automated match to d1kx3c_

Details for d4caya_

PDB Entry: 4cay, 1.48 Å

PDB Description: crystal structure of a human anp32e-h2a.z-h2b complex

PDB Compounds: (A:) histone h2a.z

SCOPe Domain Sequences for d4caya_:

Sequence, based on SEQRES records:

>d4caya_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskdlk
vkritprhlqlairgdeeldslikatiagg

Sequence, based on observed residues (ATOM records):

>d4caya_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srsqraglqfpvgrihrhlksrgrvgataavysaaileyltaevlelagnaskdlkvkri
tprhlqlairgdeeldslikatiagg

Timeline for d4caya_:

• d4caya_ first appeared in SCOPe 2.03
  
• d4caya_ appears in SCOPe 2.05
  
• d4caya_ appears in SCOPe 2.07
  
• d4caya_ appears in the current release, SCOPe 2.08