Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193446] (18 PDB entries) |
Domain d4caya_: 4cay A: [236116] automated match to d1kx3c_ |
PDB Entry: 4cay (more details), 1.48 Å
SCOPe Domain Sequences for d4caya_:
Sequence, based on SEQRES records: (download)
>d4caya_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskdlk vkritprhlqlairgdeeldslikatiagg
>d4caya_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srsqraglqfpvgrihrhlksrgrvgataavysaaileyltaevlelagnaskdlkvkri tprhlqlairgdeeldslikatiagg
Timeline for d4caya_: