SCOPe 2.07: Domain d4ki5f2: 4ki5 F:108-214

Lineage for d4ki5f2 (4ki5 F:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4ki5f2: 4ki5 F:108-214 [236048]
   Other proteins in same PDB: d4ki5d1, d4ki5d2, d4ki5f1, d4ki5m_
   automated match to d1l7tl2

Details for d4ki5f2

PDB Entry: 4ki5, 2.47 Å

PDB Description: Cystal structure of human factor VIII C2 domain in a ternary complex with murine inhbitory antibodies 3E6 and G99

PDB Compounds: (F:) murine monoclonal g99 fab light chain

SCOPe Domain Sequences for d4ki5f2:

Sequence, based on SEQRES records:

>d4ki5f2 b.1.1.2 (F:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Sequence, based on observed residues (ATOM records):

>d4ki5f2 b.1.1.2 (F:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathspivksfnrnec

Timeline for d4ki5f2:

• d4ki5f2 first appeared in SCOPe 2.03
  
• d4ki5f2 appears in SCOPe 2.06
  
• d4ki5f2 appears in the current release, SCOPe 2.08