Lineage for d4ki5f2 (4ki5 F:108-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (494 PDB entries)
  8. 2025730Domain d4ki5f2: 4ki5 F:108-214 [236048]
    Other proteins in same PDB: d4ki5d1, d4ki5d2, d4ki5f1, d4ki5m_
    automated match to d1l7tl2

Details for d4ki5f2

PDB Entry: 4ki5 (more details), 2.47 Å

PDB Description: Cystal structure of human factor VIII C2 domain in a ternary complex with murine inhbitory antibodies 3E6 and G99
PDB Compounds: (F:) murine monoclonal g99 fab light chain

SCOPe Domain Sequences for d4ki5f2:

Sequence, based on SEQRES records: (download)

>d4ki5f2 b.1.1.2 (F:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Sequence, based on observed residues (ATOM records): (download)

>d4ki5f2 b.1.1.2 (F:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathspivksfnrnec

SCOPe Domain Coordinates for d4ki5f2:

Click to download the PDB-style file with coordinates for d4ki5f2.
(The format of our PDB-style files is described here.)

Timeline for d4ki5f2: