Lineage for d4hiza2 (4hiz A:604-756)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430315Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 2430316Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 2430364Family b.108.1.0: automated matches [231970] (1 protein)
    not a true family
  6. 2430365Protein automated matches [231971] (3 species)
    not a true protein
  7. 2430373Species Enterobacteria phage [TaxId:948870] [236013] (1 PDB entry)
  8. 2430374Domain d4hiza2: 4hiz A:604-756 [236015]
    Other proteins in same PDB: d4hiza1, d4hizb1, d4hizc1
    automated match to d1v0ea2
    complexed with ca, cl, edo, mg, na, sia, slb, suc

Details for d4hiza2

PDB Entry: 4hiz (more details), 1.6 Å

PDB Description: phage phi92 endosialidase
PDB Compounds: (A:) Endosialidase

SCOPe Domain Sequences for d4hiza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hiza2 b.108.1.0 (A:604-756) automated matches {Enterobacteria phage [TaxId: 948870]}
srdfkygatpnrtlpvsmgtdgvrhvsapvtfdndvqmysltvtglehdgtqqsavrvkl
dgdygviaknipiknpseqrlilcggetpyttdgsllqlygsnhtypnrailyapggayt
qnnfmpyldgqvslggasnrwsevyastgtint

SCOPe Domain Coordinates for d4hiza2:

Click to download the PDB-style file with coordinates for d4hiza2.
(The format of our PDB-style files is described here.)

Timeline for d4hiza2: