![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily) (homo)trimer; each chain donates 3 beta-strands per turn of the helix |
![]() | Superfamily b.108.1: Phage fibre proteins [69349] (6 families) ![]() |
![]() | Family b.108.1.0: automated matches [231970] (1 protein) not a true family |
![]() | Protein automated matches [231971] (3 species) not a true protein |
![]() | Species Enterobacteria phage [TaxId:948870] [236013] (1 PDB entry) |
![]() | Domain d4hiza2: 4hiz A:604-756 [236015] Other proteins in same PDB: d4hiza1, d4hizb1 automated match to d1v0ea2 complexed with ca, cl, edo, mg, na, suc |
PDB Entry: 4hiz (more details), 1.6 Å
SCOPe Domain Sequences for d4hiza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hiza2 b.108.1.0 (A:604-756) automated matches {Enterobacteria phage [TaxId: 948870]} srdfkygatpnrtlpvsmgtdgvrhvsapvtfdndvqmysltvtglehdgtqqsavrvkl dgdygviaknipiknpseqrlilcggetpyttdgsllqlygsnhtypnrailyapggayt qnnfmpyldgqvslggasnrwsevyastgtint
Timeline for d4hiza2: