SCOPe 2.07: Domain d4hizc2: 4hiz C:604-756

Lineage for d4hizc2 (4hiz C:604-756)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
   (homo)trimer; each chain donates 3 beta-strands per turn of the helix

4. Superfamily b.108.1: Phage fibre proteins [69349] (6 families)

5. Family b.108.1.0: automated matches [231970] (1 protein)
   not a true family

6. Protein automated matches [231971] (3 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:948870] [236013] (1 PDB entry)

8. Domain d4hizc2: 4hiz C:604-756 [240205]
   Other proteins in same PDB: d4hiza1, d4hizb1, d4hizc1
   automated match to d4hiza2
   complexed with ca, cl, edo, mg, na, sia, slb, suc

Details for d4hizc2

PDB Entry: 4hiz, 1.6 Å

PDB Description: phage phi92 endosialidase

PDB Compounds: (C:) Endosialidase

SCOPe Domain Sequences for d4hizc2:

Sequence; same for both SEQRES and ATOM records:

>d4hizc2 b.108.1.0 (C:604-756) automated matches {Enterobacteria phage [TaxId: 948870]}
srdfkygatpnrtlpvsmgtdgvrhvsapvtfdndvqmysltvtglehdgtqqsavrvkl
dgdygviaknipiknpseqrlilcggetpyttdgsllqlygsnhtypnrailyapggayt
qnnfmpyldgqvslggasnrwsevyastgtint

Timeline for d4hizc2:

• d4hizc2 first appeared in SCOPe 2.04
  
• d4hizc2 appears in SCOPe 2.06
  
• d4hizc2 appears in the current release, SCOPe 2.08