| Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
| Protein automated matches [226934] (14 species) not a true protein |
| Species Oscillatoria sp. [TaxId:272129] [229249] (1 PDB entry) |
| Domain d4irnc1: 4irn C:4-230 [235873] Other proteins in same PDB: d4irna2, d4irnb2, d4irnc2, d4irnd2, d4irne2, d4irng2, d4irnh2 automated match to d4irnf1 complexed with fad |
PDB Entry: 4irn (more details), 2.8 Å
SCOPe Domain Sequences for d4irnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irnc1 e.6.1.0 (C:4-230) automated matches {Oscillatoria sp. [TaxId: 272129]}
awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgee
Timeline for d4irnc1: