Class a: All alpha proteins [46456] (284 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (15 species) not a true protein |
Species Oscillatoria sp. [TaxId:272129] [229251] (1 PDB entry) |
Domain d4irna2: 4irn A:231-381 [235872] Other proteins in same PDB: d4irna1, d4irnb1, d4irnc1, d4irnd1, d4irne1, d4irng1, d4irnh1 automated match to d4irnf2 complexed with fad |
PDB Entry: 4irn (more details), 2.8 Å
SCOPe Domain Sequences for d4irna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irna2 a.29.3.0 (A:231-381) automated matches {Oscillatoria sp. [TaxId: 272129]} gtglaifnhsmewergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvem klrlenakaylykvawmkenkqmalleasmanlyiseawvqscleaieihgaygyltnte lerelrdaiaskfysgtseiqrvviakflgl
Timeline for d4irna2: