Lineage for d4irnc2 (4irn C:231-381)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267383Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1267512Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1267513Protein automated matches [226935] (15 species)
    not a true protein
  7. 1267610Species Oscillatoria sp. [TaxId:272129] [229251] (1 PDB entry)
  8. 1267613Domain d4irnc2: 4irn C:231-381 [235874]
    Other proteins in same PDB: d4irna1, d4irnb1, d4irnc1, d4irnd1, d4irne1, d4irng1, d4irnh1
    automated match to d4irnf2
    complexed with fad

Details for d4irnc2

PDB Entry: 4irn (more details), 2.8 Å

PDB Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB
PDB Compounds: (C:) Prolyl-ACP dehydrogenase

SCOPe Domain Sequences for d4irnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irnc2 a.29.3.0 (C:231-381) automated matches {Oscillatoria sp. [TaxId: 272129]}
gtglaifnhsmewergfilaaavgtmerlleqsiryarshkqfgqaigkfqlvanklvem
klrlenakaylykvawmkenkqmalleasmanlyiseawvqscleaieihgaygyltnte
lerelrdaiaskfysgtseiqrvviakflgl

SCOPe Domain Coordinates for d4irnc2:

Click to download the PDB-style file with coordinates for d4irnc2.
(The format of our PDB-style files is described here.)

Timeline for d4irnc2: