SCOPe 2.08: Domain d4irnc1: 4irn C:4-230

Lineage for d4irnc1 (4irn C:4-230)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (29 species)
   not a true protein

7. Species Oscillatoria sp. [TaxId:272129] [229249] (1 PDB entry)

8. Domain d4irnc1: 4irn C:4-230 [235873]
   Other proteins in same PDB: d4irna2, d4irnb2, d4irnc2, d4irnd2, d4irne2, d4irnf2, d4irng2, d4irnh2
   automated match to d4irnf1
   complexed with fad

Details for d4irnc1

PDB Entry: 4irn, 2.8 Å

PDB Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB

PDB Compounds: (C:) Prolyl-ACP dehydrogenase

SCOPe Domain Sequences for d4irnc1:

Sequence; same for both SEQRES and ATOM records:

>d4irnc1 e.6.1.0 (C:4-230) automated matches {Oscillatoria sp. [TaxId: 272129]}
awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgee

Timeline for d4irnc1:

• d4irnc1 first appeared in SCOPe 2.03
  
• d4irnc1 appears in SCOPe 2.07