Lineage for d4lmra1 (4lmr A:3-147)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580257Species Bacillus cereus [TaxId:226900] [189455] (3 PDB entries)
  8. 1580262Domain d4lmra1: 4lmr A:3-147 [235418]
    Other proteins in same PDB: d4lmra2, d4lmrb2
    automated match to d4ln1d1

Details for d4lmra1

PDB Entry: 4lmr (more details), 2.45 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579, nysgrc target 029452
PDB Compounds: (A:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d4lmra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmra1 c.2.1.0 (A:3-147) automated matches {Bacillus cereus [TaxId: 226900]}
kginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlshavpfapaptr
vwkgsyedckdadlvvitaglpqkpgetrldlveknakifkqivrsimdsgfdgifliat
npvdiltyvtwkesglpkervigsg

SCOPe Domain Coordinates for d4lmra1:

Click to download the PDB-style file with coordinates for d4lmra1.
(The format of our PDB-style files is described here.)

Timeline for d4lmra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lmra2