| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
| Protein automated matches [226850] (24 species) not a true protein |
| Species Bacillus cereus [TaxId:226900] [226735] (2 PDB entries) |
| Domain d4lmra2: 4lmr A:148-314 [235419] Other proteins in same PDB: d4lmra1, d4lmrb1 automated match to d4ln1d2 |
PDB Entry: 4lmr (more details), 2.45 Å
SCOPe Domain Sequences for d4lmra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lmra2 d.162.1.0 (A:148-314) automated matches {Bacillus cereus [TaxId: 226900]}
ttldsarfrymlgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntyn
qedldkifinvrdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygq
kdvyigvpavlnrggvreilevelsedeelkfdhsvqvlketmapvl
Timeline for d4lmra2: