Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [189455] (4 PDB entries) |
Domain d4lmra1: 4lmr A:3-147 [235418] Other proteins in same PDB: d4lmra2, d4lmrb2 automated match to d4ln1d1 |
PDB Entry: 4lmr (more details), 2.45 Å
SCOPe Domain Sequences for d4lmra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lmra1 c.2.1.0 (A:3-147) automated matches {Bacillus cereus [TaxId: 226900]} kginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlshavpfapaptr vwkgsyedckdadlvvitaglpqkpgetrldlveknakifkqivrsimdsgfdgifliat npvdiltyvtwkesglpkervigsg
Timeline for d4lmra1: