![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.1: AFP III-like domain [51269] (2 families) ![]() duplication: consists of two structural repeats related by pseudo dyad |
![]() | Family b.85.1.0: automated matches [231476] (1 protein) not a true family |
![]() | Protein automated matches [231477] (2 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:487] [234894] (2 PDB entries) |
![]() | Domain d4ipia2: 4ipi A:282-349 [234895] Other proteins in same PDB: d4ipia1, d4ipia3 automated match to d1xuua1 complexed with lmr, mn |
PDB Entry: 4ipi (more details), 1.75 Å
SCOPe Domain Sequences for d4ipia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ipia2 b.85.1.0 (A:282-349) automated matches {Neisseria meningitidis [TaxId: 487]} ekptkdfafasvvadkdikkgellsgdnlwvkapgngdfsvneyetlfgkvaacnirkga qikktdie
Timeline for d4ipia2: