Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.1: AFP III-like domain [51269] (2 families) duplication: consists of two structural repeats related by pseudo dyad |
Family b.85.1.1: AFP III-like domain [51270] (4 proteins) Pfam PF01354 |
Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (2 species) |
Species Neisseria meningitidis [TaxId:487] [117331] (4 PDB entries) Uniprot Q57265 |
Domain d1xuua1: 1xuu A:282-349 [116067] Other proteins in same PDB: d1xuua2 complexed with mlt, mn |
PDB Entry: 1xuu (more details), 1.9 Å
SCOPe Domain Sequences for d1xuua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuua1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]} ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga qikktdie
Timeline for d1xuua1: