Lineage for d4ipia2 (4ipi A:282-349)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817865Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2817944Family b.85.1.0: automated matches [231476] (1 protein)
    not a true family
  6. 2817945Protein automated matches [231477] (2 species)
    not a true protein
  7. 2817946Species Neisseria meningitidis [TaxId:487] [234894] (2 PDB entries)
  8. 2817947Domain d4ipia2: 4ipi A:282-349 [234895]
    Other proteins in same PDB: d4ipia1, d4ipia3
    automated match to d1xuua1
    complexed with lmr, mn

Details for d4ipia2

PDB Entry: 4ipi (more details), 1.75 Å

PDB Description: Crystal Structure of R314A N-acetyl Neuraminic Acid Synthase from Neiserria meningitidis with Malate bound
PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d4ipia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ipia2 b.85.1.0 (A:282-349) automated matches {Neisseria meningitidis [TaxId: 487]}
ekptkdfafasvvadkdikkgellsgdnlwvkapgngdfsvneyetlfgkvaacnirkga
qikktdie

SCOPe Domain Coordinates for d4ipia2:

Click to download the PDB-style file with coordinates for d4ipia2.
(The format of our PDB-style files is described here.)

Timeline for d4ipia2: