Lineage for d4i76b2 (4i76 B:76-200)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008425Protein Transcriptional regulator TM1030 [140877] (1 species)
  7. 2008426Species Thermotoga maritima [TaxId:2336] [140878] (8 PDB entries)
    Uniprot Q9X0C0 76-200
  8. 2008430Domain d4i76b2: 4i76 B:76-200 [234829]
    Other proteins in same PDB: d4i76a1, d4i76b1
    automated match to d2id6a2
    complexed with edo, oc9

Details for d4i76b2

PDB Entry: 4i76 (more details), 2.1 Å

PDB Description: crystal structure of transcriptional regulator tm1030 with octanol
PDB Compounds: (B:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d4i76b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i76b2 a.121.1.1 (B:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek
lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk
kgmtk

SCOPe Domain Coordinates for d4i76b2:

Click to download the PDB-style file with coordinates for d4i76b2.
(The format of our PDB-style files is described here.)

Timeline for d4i76b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i76b1