Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Transcriptional regulator TM1030 [140877] (1 species) |
Species Thermotoga maritima [TaxId:2336] [140878] (8 PDB entries) Uniprot Q9X0C0 76-200 |
Domain d4i76b2: 4i76 B:76-200 [234829] Other proteins in same PDB: d4i76a1, d4i76b1 automated match to d2id6a2 complexed with edo, oc9 |
PDB Entry: 4i76 (more details), 2.1 Å
SCOPe Domain Sequences for d4i76b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i76b2 a.121.1.1 (B:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk kgmtk
Timeline for d4i76b2: