PDB entry 4i76

View 4i76 on RCSB PDB site
Description: Crystal structure of transcriptional regulator TM1030 with octanol
Class: Transcription Regulator
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, PFAM TetR_N, helix-turn-helix, Transcriptional regulator, DNA Binding, Transcription Regulator
Deposited on 2012-11-30, released 2013-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM1030, TM_1030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i76a1, d4i76a2
  • Chain 'B':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM1030, TM_1030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i76b1, d4i76b2
  • Heterogens: OC9, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i76A (A:)
    ghmlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsv
    teklqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkril
    ldleksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkr
    dmntlveevkvmlrilkkgmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i76A (A:)
    skrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtekl
    qkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldle
    ksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmnt
    lveevkvmlrilkkgmtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i76B (B:)
    ghmlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsv
    teklqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkril
    ldleksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkr
    dmntlveevkvmlrilkkgmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i76B (B:)
    mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
    klqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilld
    leksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdm
    ntlveevkvmlrilkkgmtk