Lineage for d4i76a1 (4i76 A:3-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981851Protein Transcriptional regulator TM1030 [140209] (1 species)
  7. 1981852Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries)
    Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75
  8. 1981855Domain d4i76a1: 4i76 A:3-75 [234826]
    Other proteins in same PDB: d4i76a2, d4i76b2
    automated match to d2id6a1
    complexed with edo, oc9

Details for d4i76a1

PDB Entry: 4i76 (more details), 2.1 Å

PDB Description: crystal structure of transcriptional regulator tm1030 with octanol
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d4i76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i76a1 a.4.1.9 (A:3-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
skrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtekl
qkefenflmknrn

SCOPe Domain Coordinates for d4i76a1:

Click to download the PDB-style file with coordinates for d4i76a1.
(The format of our PDB-style files is described here.)

Timeline for d4i76a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i76a2