Lineage for d4i6uc_ (4i6u C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709766Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2709767Protein automated matches [190907] (21 species)
    not a true protein
  7. 2709779Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)
  8. 2709796Domain d4i6uc_: 4i6u C: [234823]
    automated match to d4i6ue_
    complexed with act, gol, na, peg; mutant

Details for d4i6uc_

PDB Entry: 4i6u (more details), 1.97 Å

PDB Description: Crystal Structure of a Y37F mutant of the Restriction-Modification Controller Protein C.Esp1396I
PDB Compounds: (C:) Regulatory protein

SCOPe Domain Sequences for d4i6uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6uc_ a.35.1.0 (C:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtfisgiernsrnltikslelimkglev
sdvvffemlikeilk

SCOPe Domain Coordinates for d4i6uc_:

Click to download the PDB-style file with coordinates for d4i6uc_.
(The format of our PDB-style files is described here.)

Timeline for d4i6uc_: