Lineage for d4i6ud_ (4i6u D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318756Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2318757Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2319204Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2319205Protein automated matches [190907] (14 species)
    not a true protein
  7. 2319210Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)
  8. 2319228Domain d4i6ud_: 4i6u D: [234824]
    automated match to d4i6ue_
    complexed with act, gol, na, peg; mutant

Details for d4i6ud_

PDB Entry: 4i6u (more details), 1.97 Å

PDB Description: Crystal Structure of a Y37F mutant of the Restriction-Modification Controller Protein C.Esp1396I
PDB Compounds: (D:) Regulatory protein

SCOPe Domain Sequences for d4i6ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6ud_ a.35.1.0 (D:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtfisgiernsrnltikslelimkglev
sdvvffemlikeilkh

SCOPe Domain Coordinates for d4i6ud_:

Click to download the PDB-style file with coordinates for d4i6ud_.
(The format of our PDB-style files is described here.)

Timeline for d4i6ud_: