Lineage for d4i6ga1 (4i6g A:21-223)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120447Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2120448Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2120484Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 2120485Protein automated matches [227113] (2 species)
    not a true protein
  7. 2120493Species Mouse (Mus musculus) [TaxId:10090] [226619] (5 PDB entries)
  8. 2120498Domain d4i6ga1: 4i6g A:21-223 [234816]
    Other proteins in same PDB: d4i6ga2, d4i6gb2
    automated match to d4mlpd1
    complexed with fad

Details for d4i6ga1

PDB Entry: 4i6g (more details), 2.2 Å

PDB Description: a vertebrate cryptochrome with FAD
PDB Compounds: (A:) Cryptochrome-2

SCOPe Domain Sequences for d4i6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6ga1 c.28.1.0 (A:21-223) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfptegl

SCOPe Domain Coordinates for d4i6ga1:

Click to download the PDB-style file with coordinates for d4i6ga1.
(The format of our PDB-style files is described here.)

Timeline for d4i6ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i6ga2