| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) ![]() automatically mapped to Pfam PF00875 |
| Family c.28.1.0: automated matches [227292] (1 protein) not a true family |
| Protein automated matches [227113] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [226619] (17 PDB entries) |
| Domain d4i6ga1: 4i6g A:21-223 [234816] Other proteins in same PDB: d4i6ga2, d4i6gb2 automated match to d4mlpd1 complexed with fad |
PDB Entry: 4i6g (more details), 2.2 Å
SCOPe Domain Sequences for d4i6ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i6ga1 c.28.1.0 (A:21-223) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfptegl
Timeline for d4i6ga1: