Lineage for d4mlpd1 (4mlp D:21-223)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120447Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2120448Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2120484Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 2120485Protein automated matches [227113] (2 species)
    not a true protein
  7. 2120493Species Mouse (Mus musculus) [TaxId:10090] [226619] (5 PDB entries)
  8. 2120497Domain d4mlpd1: 4mlp D:21-223 [228406]
    Other proteins in same PDB: d4mlpa2, d4mlpb2, d4mlpc2, d4mlpd2
    automated match to d4k0ra1
    complexed with 2cx

Details for d4mlpd1

PDB Entry: 4mlp (more details), 1.94 Å

PDB Description: Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
PDB Compounds: (D:) Cryptochrome-2

SCOPe Domain Sequences for d4mlpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlpd1 c.28.1.0 (D:21-223) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfptegl

SCOPe Domain Coordinates for d4mlpd1:

Click to download the PDB-style file with coordinates for d4mlpd1.
(The format of our PDB-style files is described here.)

Timeline for d4mlpd1: