SCOPe 2.06: Domain d4mlpc1: 4mlp C:21-223

Lineage for d4mlpc1 (4mlp C:21-223)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226619] (5 PDB entries)

8. Domain d4mlpc1: 4mlp C:21-223 [229905]
   Other proteins in same PDB: d4mlpa2, d4mlpb2, d4mlpc2, d4mlpd2
   automated match to d4mlpd1
   complexed with 2cx

Details for d4mlpc1

PDB Entry: 4mlp, 1.94 Å

PDB Description: Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase

PDB Compounds: (C:) Cryptochrome-2

SCOPe Domain Sequences for d4mlpc1:

Sequence; same for both SEQRES and ATOM records:

>d4mlpc1 c.28.1.0 (C:21-223) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfptegl

Timeline for d4mlpc1:

• d4mlpc1 first appeared in SCOPe 2.03
  
• d4mlpc1 appears in SCOPe 2.05
  
• d4mlpc1 appears in SCOPe 2.07
  
• d4mlpc1 appears in the current release, SCOPe 2.08