Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (24 species) not a true protein |
Species Plasmodium knowlesi [TaxId:5851] [234464] (1 PDB entry) |
Domain d4ggnc_: 4ggn C: [234467] automated match to d1ggwa_ |
PDB Entry: 4ggn (more details), 2.29 Å
SCOPe Domain Sequences for d4ggnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggnc_ a.39.1.0 (C:) automated matches {Plasmodium knowlesi [TaxId: 5851]} dmfntkssngklriedashnarklglapsstdekkirdlygdsltyeqyleyltmcvhdr dnmeelikmfshfdnnssgfltknqmknilttwgdalteqeandalnafssedrinyklf cedils
Timeline for d4ggnc_: