Lineage for d4ggnc_ (4ggn C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711798Species Plasmodium knowlesi [TaxId:5851] [234464] (1 PDB entry)
  8. 2711801Domain d4ggnc_: 4ggn C: [234467]
    automated match to d1ggwa_

Details for d4ggnc_

PDB Entry: 4ggn (more details), 2.29 Å

PDB Description: malaria invasion machinery protein complex
PDB Compounds: (C:) Myosin A tail domain interacting protein MTIP

SCOPe Domain Sequences for d4ggnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ggnc_ a.39.1.0 (C:) automated matches {Plasmodium knowlesi [TaxId: 5851]}
dmfntkssngklriedashnarklglapsstdekkirdlygdsltyeqyleyltmcvhdr
dnmeelikmfshfdnnssgfltknqmknilttwgdalteqeandalnafssedrinyklf
cedils

SCOPe Domain Coordinates for d4ggnc_:

Click to download the PDB-style file with coordinates for d4ggnc_.
(The format of our PDB-style files is described here.)

Timeline for d4ggnc_: