SCOP 1.63: Domain d1piv3_: 1piv 3:

Lineage for d1piv3_ (1piv 3:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (18 proteins)
   mammalian viruses

6. Protein Poliovirus [49666] (3 species)

7. Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries)

8. Domain d1piv3_: 1piv 3: [23437]
   complexed with myr, w71

Details for d1piv3_

PDB Entry: 1piv, 2.9 Å

PDB Description: binding of the antiviral drug win51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14

SCOP Domain Sequences for d1piv3_:

Sequence; same for both SEQRES and ATOM records:

>d1piv3_ b.10.1.4 (3:) Poliovirus {Poliovirus type 3, strain Sabin}
glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsa

Timeline for d1piv3_:

• d1piv3_ first appeared (with stable ids) in SCOP 1.55
  
• d1piv3_ appears in SCOP 1.61
  
• d1piv3_ appears in SCOP 1.65
  
• d1piv3_ appears in the current release, SCOPe 2.08