SCOPe 2.04: Domain d4b1yb2: 4b1y B:147-375

Lineage for d4b1yb2 (4b1y B:147-375)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (11 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (9 PDB entries)

8. Domain d4b1yb2: 4b1y B:147-375 [234118]
   Other proteins in same PDB: d4b1yb1
   automated match to d2btfa2
   complexed with 1pe, atp, gol, lab, mg, p6g, peg

Details for d4b1yb2

PDB Entry: 4b1y, 1.29 Å

PDB Description: structure of the phactr1 rpel-3 bound to g-actin

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4b1yb2:

Sequence; same for both SEQRES and ATOM records:

>d4b1yb2 c.55.1.1 (B:147-375) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

Timeline for d4b1yb2:

• d4b1yb2 first appeared in SCOPe 2.03
  
• d4b1yb2 appears in SCOPe 2.05
  
• d4b1yb2 appears in the current release, SCOPe 2.08