Lineage for d4b1yb2 (4b1y B:147-375)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2461320Protein automated matches [226905] (13 species)
    not a true protein
  7. 2461527Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (11 PDB entries)
  8. 2461528Domain d4b1yb2: 4b1y B:147-375 [234118]
    Other proteins in same PDB: d4b1yb1
    automated match to d2btfa2
    complexed with 1pe, atp, gol, lab, mg, p6g, peg

Details for d4b1yb2

PDB Entry: 4b1y (more details), 1.29 Å

PDB Description: structure of the phactr1 rpel-3 bound to g-actin
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4b1yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b1yb2 c.55.1.1 (B:147-375) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d4b1yb2:

Click to download the PDB-style file with coordinates for d4b1yb2.
(The format of our PDB-style files is described here.)

Timeline for d4b1yb2: