SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4b1yb2 (4b1y B:147-375)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122439Protein automated matches [226905] (12 species)
    not a true protein
  7. 2122544Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (9 PDB entries)
  8. 2122545Domain d4b1yb2: 4b1y B:147-375 [234118]
    Other proteins in same PDB: d4b1yb1
    automated match to d2btfa2
    complexed with 1pe, atp, gol, lab, mg, p6g, peg

Details for d4b1yb2

PDB Entry: 4b1y (more details), 1.29 Å

PDB Description: Structure of the Phactr1 RPEL-3 bound to G-actin
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4b1yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b1yb2 c.55.1.1 (B:147-375) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d4b1yb2:

Click to download the PDB-style file with coordinates for d4b1yb2.
(The format of our PDB-style files is described here.)

Timeline for d4b1yb2: