SCOPe 2.07: Domain d3stjb1: 3stj B:11-236

Lineage for d3stjb1 (3stj B:11-236)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (33 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226179] (2 PDB entries)

8. Domain d3stjb1: 3stj B:11-236 [233622]
   Other proteins in same PDB: d3stja2, d3stjb2, d3stjc2, d3stjd2, d3stje2, d3stjf2, d3stjg2, d3stjh2, d3stji2, d3stjj2, d3stjk2, d3stjl2
   automated match to d1ky9a2

Details for d3stjb1

PDB Entry: 3stj, 2.6 Å

PDB Description: Crystal structure of the protease + PDZ1 domain of DegQ from Escherichia coli

PDB Compounds: (B:) Protease degQ

SCOPe Domain Sequences for d3stjb1:

Sequence, based on SEQRES records:

>d3stjb1 b.47.1.0 (B:11-236) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqpfeglgsgvii
naskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqnpskltqiaia
dsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtdasinrgnsgga
llnlngeligintailapgggsvgigfaipsnmartlaqqlidfge

Sequence, based on observed residues (ATOM records):

>d3stjb1 b.47.1.0 (B:11-236) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plpslapmlekvlpavvsvrvegtqpfeglgsgviinaskgyvltnnhvinqaqkisiql
ndgrefdakligsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqta
tsgivsalgrsglnleglenfiqtdasinrgnsggallnlngeligintailapgggsvg
igfaipsnmartlaqqlidfge

Timeline for d3stjb1:

• d3stjb1 first appeared in SCOPe 2.03
  
• d3stjb1 appears in SCOPe 2.06
  
• d3stjb1 appears in the current release, SCOPe 2.08