Lineage for d1ky9a2 (1ky9 A:11-259)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) 
Protein Protease Do (DegP, HtrA), catalytic domain [74969] (2 species) 
Species Escherichia coli [TaxId:562] [74970] (4 PDB entries) 
Domain d1ky9a2: 1ky9 A:11-259 [73199]
Other proteins in same PDB: d1ky9a1, d1ky9b1, d1ky9b2
Details for d1ky9a2
PDB Entry: 1ky9 (more details), 2.8 Å
PDB Description: crystal structure of degp (htra)
PDB Compounds: (A:) Protease doSCOPe Domain Sequences for d1ky9a2:
Sequence, based on SEQRES records: (download)
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}
qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqegspfqsspfcq
ggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdgrkfdakmvgk
dprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsgivsalgrsgl
naenyenfiqtdaainrgnaggalvnlngeligintailapdggnigigfaipsnmvknl
tsqmveygq
Sequence, based on observed residues (ATOM records): (download)
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}
qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
lrvgdytvaignpfglgetvtsgivsalgrsgyenfiqtdaainrgnaggalvnlngeli
gintailapdggnigigfaipsnmvknltsqmveygq
SCOPe Domain Coordinates for d1ky9a2:
Click to download the PDB-style file with coordinates for d1ky9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ky9a2:
- d1ky9a2 first appeared in SCOP 1.61
- d1ky9a2 appears in SCOPe 2.06
- d1ky9a2 appears in the current release, SCOPe 2.08
View in 3D
