Lineage for d3stjk2 (3stj K:237-334)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396113Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2396114Protein automated matches [190436] (9 species)
    not a true protein
  7. 2396115Species Escherichia coli K-12 [TaxId:83333] [233623] (1 PDB entry)
  8. 2396126Domain d3stjk2: 3stj K:237-334 [239772]
    Other proteins in same PDB: d3stja1, d3stjb1, d3stjc1, d3stjd1, d3stje1, d3stjf1, d3stjg1, d3stjh1, d3stji1, d3stjj1, d3stjk1, d3stjl1
    automated match to d3stjb2

Details for d3stjk2

PDB Entry: 3stj (more details), 2.6 Å

PDB Description: Crystal structure of the protease + PDZ1 domain of DegQ from Escherichia coli
PDB Compounds: (K:) Protease degQ

SCOPe Domain Sequences for d3stjk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3stjk2 b.36.1.0 (K:237-334) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ikrgllgikgtemsadiakafnldvqrgafvsevlpgsgsakagvkagdiitslngkpln
sfaelrsriattepgtkvklgllrngkplevevtldts

SCOPe Domain Coordinates for d3stjk2:

Click to download the PDB-style file with coordinates for d3stjk2.
(The format of our PDB-style files is described here.)

Timeline for d3stjk2: