SCOPe 2.08: Domain d3sl4b_: 3sl4 B:

Lineage for d3sl4b_ (3sl4 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
   Uniprot Q08499 388-713

8. Domain d3sl4b_: 3sl4 B: [233546]
   automated match to d2fm0a_
   complexed with dms, edo, epe, jn4, peg, po4, zn

Details for d3sl4b_

PDB Entry: 3sl4, 1.9 Å

PDB Description: crystal structure of the catalytic domain of pde4d2 with compound 10d

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d3sl4b_:

Sequence; same for both SEQRES and ATOM records:

>d3sl4b_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
vhpdaqdildtlednrewyqstipq

Timeline for d3sl4b_:

• d3sl4b_ first appeared in SCOPe 2.03
  
• d3sl4b_ appears in SCOPe 2.07