PDB entry 3sl4

View 3sl4 on RCSB PDB site
Description: Crystal structure of the catalytic domain of PDE4D2 with compound 10D
Class: Hydrolase/Inhibitor
Keywords: catalytic mechanism, cAMP hydrolysis, Hydrolase-Inhibitor complex
Deposited on 2011-06-24, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl4a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl4b_
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl4c_
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sl4d_
  • Heterogens: ZN, EDO, DMS, PEG, PO4, JN4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sl4A (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl4A (A:)
    gvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtl
    itylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdv
    dhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrk
    mvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnp
    tkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwe
    twadlvhpdaqdildtlednrewyqstip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sl4B (B:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl4B (B:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstipq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sl4C (C:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl4C (C:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqsti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sl4D (D:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sl4D (D:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstip