Lineage for d3r60b2 (3r60 B:63-139)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331932Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2331933Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2331934Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2332019Protein automated matches [233398] (2 species)
    not a true protein
  7. 2332020Species Bacillus subtilis [TaxId:1423] [233399] (3 PDB entries)
  8. 2332024Domain d3r60b2: 3r60 B:63-139 [233402]
    Other proteins in same PDB: d3r60a1, d3r60b1
    automated match to d1on2a2
    complexed with epe, fe2, pgo

Details for d3r60b2

PDB Entry: 3r60 (more details), 1.8 Å

PDB Description: Structure of the MntR Fe2+ Complex
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d3r60b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r60b2 a.76.1.1 (B:63-139) automated matches {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkkteh

SCOPe Domain Coordinates for d3r60b2:

Click to download the PDB-style file with coordinates for d3r60b2.
(The format of our PDB-style files is described here.)

Timeline for d3r60b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r60b1