Class a: All alpha proteins [46456] (289 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) automatically mapped to Pfam PF02742 |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
Protein automated matches [233398] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [233399] (3 PDB entries) |
Domain d3r60b2: 3r60 B:63-139 [233402] Other proteins in same PDB: d3r60a1, d3r60b1 automated match to d1on2a2 complexed with epe, fe2, pgo |
PDB Entry: 3r60 (more details), 1.8 Å
SCOPe Domain Sequences for d3r60b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r60b2 a.76.1.1 (B:63-139) automated matches {Bacillus subtilis [TaxId: 1423]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqkkteh
Timeline for d3r60b2: