SCOPe 2.07: Domain d3r60b1: 3r60 B:4-62

Lineage for d3r60b1 (3r60 B:4-62)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein automated matches [233395] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [233396] (3 PDB entries)

8. Domain d3r60b1: 3r60 B:4-62 [233401]
   Other proteins in same PDB: d3r60a2, d3r60b2
   automated match to d1on1a1
   complexed with epe, fe2, pgo

Details for d3r60b1

PDB Entry: 3r60, 1.8 Å

PDB Description: Structure of the MntR Fe2+ Complex

PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d3r60b1:

Sequence, based on SEQRES records:

>d3r60b1 a.4.5.24 (B:4-62) automated matches {Bacillus subtilis [TaxId: 1423]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Sequence, based on observed residues (ATOM records):

>d3r60b1 a.4.5.24 (B:4-62) automated matches {Bacillus subtilis [TaxId: 1423]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyeglvl

Timeline for d3r60b1:

• d3r60b1 first appeared in SCOPe 2.03
  
• d3r60b1 appears in SCOPe 2.06
  
• d3r60b1 appears in the current release, SCOPe 2.08