SCOPe 2.08: Domain d3pseb2: 3pse B:79-156

Lineage for d3pseb2 (3pse B:79-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)

8. Domain d3pseb2: 3pse B:79-156 [233269]
   automated match to d1z2ma2
   complexed with 3cn, gol

Details for d3pseb2

PDB Entry: 3pse, 2.3 Å

PDB Description: Structure of a viral OTU domain protease bound to interferon-stimulated gene 15 (ISG15)

PDB Compounds: (B:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d3pseb2:

Sequence; same for both SEQRES and ATOM records:

>d3pseb2 d.15.1.1 (B:79-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deplnilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
eyglkplstvfmnlrlrg

Timeline for d3pseb2:

• d3pseb2 first appeared in SCOPe 2.03
  
• d3pseb2 appears in SCOPe 2.07