Lineage for d3pseb1 (3pse B:4-78)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932509Domain d3pseb1: 3pse B:4-78 [233268]
    automated match to d1z2ma1
    complexed with 3cn, gol

Details for d3pseb1

PDB Entry: 3pse (more details), 2.3 Å

PDB Description: Structure of a viral OTU domain protease bound to interferon-stimulated gene 15 (ISG15)
PDB Compounds: (B:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d3pseb1:

Sequence, based on SEQRES records: (download)

>d3pseb1 d.15.1.1 (B:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
glgpgstvllvvdks

Sequence, based on observed residues (ATOM records): (download)

>d3pseb1 d.15.1.1 (B:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltvkmlagnefqvslmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasqglg
pgstvllvvdks

SCOPe Domain Coordinates for d3pseb1:

Click to download the PDB-style file with coordinates for d3pseb1.
(The format of our PDB-style files is described here.)

Timeline for d3pseb1: