SCOP 1.59: Domain d1f15a_: 1f15 A:

Lineage for d1f15a_ (1f15 A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (15 proteins)

6. Protein CMV coat protein [49645] (1 species)

7. Species Cucumber mosaic virus, strain fny [TaxId:12305] [49646] (1 PDB entry)

8. Domain d1f15a_: 1f15 A: [23320]

Details for d1f15a_

PDB Entry: 1f15, 3.2 Å

PDB Description: cucumber mosaic virus (strain fny)

SCOP Domain Sequences for d1f15a_:

Sequence; same for both SEQRES and ATOM records:

>d1f15a_ b.10.1.2 (A:) CMV coat protein {Cucumber mosaic virus, strain fny}
ercrpgytftsitlkppkidrgsyygkrlllpdsvteydkklvsrlqirvnplpkfdstv
wvtvrkvpassdlsvaaisamfadgaspvlvyqyaasgvqannkllydlsamradigdmr
kyavlvyskddaletdelvlhvdiehqriptsgvlpv

Timeline for d1f15a_:

• d1f15a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f15a_ appears in SCOP 1.57
  
• d1f15a_ appears in SCOP 1.61
  
• d1f15a_ appears in the current release, SCOPe 2.08